PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00020986-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 185aa    MW: 21049.9 Da    PI: 8.6349
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00020986-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR137.38.7e-12721105189
                   FAR1  51 errtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            +r++ra+tr gCka+++++ke++g w ++kle++H+H+l
  SMil_00020986-RA_Salv  72 RRKPRAVTREGCKAMVMIRKEDSGAWIIAKLETQHSHPL 110
                            7999*********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031018.7E-1071110IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSDGGEMVNF YDEKDFSSQE LCLNVEAPRV GMEFESEESA MAYYDAYAKR VGFIIRIGNC  60
HRSSLNGSVI SRRKPRAVTR EGCKAMVMIR KEDSGAWIIA KLETQHSHPL GVSPGKPRRG  120
PLRSQSQDEK DKRIRELSTE LHRTKQKLAE CQKQLSAILS DVELHVDHLA RSVQHLVQNV  180
KEIER
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089602.13e-82PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_011089604.11e-82PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X3
TrEMBLA0A0A0KA595e-53A0A0A0KA59_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA127911520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.12e-46FAR1 family protein